![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
![]() | Protein automated matches [190400] (4 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [187472] (4 PDB entries) |
![]() | Domain d2ji5b_: 2ji5 B: [166207] automated match to d2bmua1 complexed with utp |
PDB Entry: 2ji5 (more details), 2.45 Å
SCOPe Domain Sequences for d2ji5b_:
Sequence, based on SEQRES records: (download)
>d2ji5b_ c.73.1.3 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]} hmrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfn ssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpght tdavaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekag sssvidplaakiiartgiktivigkedakdlfrvikgdhngttiep
>d2ji5b_ c.73.1.3 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]} hmrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfn ssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpght tdavaallaeflkadllvvitnvdgvytadtakkikkmkpeelleivgsvidplaakiia rtgiktivigkedakdlfrvikgdhngttiep
Timeline for d2ji5b_: