SCOPe 2.05: Domain d2ji0a_: 2ji0 A:

Lineage for d2ji0a_ (2ji0 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein automated matches [190534] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187499] (9 PDB entries)

8. Domain d2ji0a_: 2ji0 A: [166205]
   automated match to d1ft3a_
   complexed with so4; mutant

Details for d2ji0a_

PDB Entry: 2ji0, 2.1 Å

PDB Description: crystal structure of rhogdi k138y, k141y mutant

PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2ji0a_:

Sequence; same for both SEQRES and ATOM records:

>d2ji0a_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvyidytdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

Timeline for d2ji0a_:

• d2ji0a_ first appeared in SCOPe 2.01
  
• d2ji0a_ appears in SCOPe 2.04
  
• d2ji0a_ appears in SCOPe 2.06
  
• d2ji0a_ appears in the current release, SCOPe 2.08