Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein automated matches [190534] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187499] (9 PDB entries) |
Domain d2ji0a_: 2ji0 A: [166205] automated match to d1ft3a_ complexed with so4; mutant |
PDB Entry: 2ji0 (more details), 2.1 Å
SCOPe Domain Sequences for d2ji0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji0a_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs gmkyiqhtyrkgvyidytdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd dktdhlswewnltikkdw
Timeline for d2ji0a_: