Lineage for d2ji0a_ (2ji0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765670Protein automated matches [190534] (3 species)
    not a true protein
  7. 2765673Species Human (Homo sapiens) [TaxId:9606] [187499] (10 PDB entries)
  8. 2765689Domain d2ji0a_: 2ji0 A: [166205]
    automated match to d1ft3a_
    complexed with so4; mutant

Details for d2ji0a_

PDB Entry: 2ji0 (more details), 2.1 Å

PDB Description: crystal structure of rhogdi k138y, k141y mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2ji0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji0a_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvyidytdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

SCOPe Domain Coordinates for d2ji0a_:

Click to download the PDB-style file with coordinates for d2ji0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ji0a_: