Lineage for d2jhtb_ (2jht B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770659Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 1770714Protein automated matches [190534] (2 species)
    not a true protein
  7. 1770717Species Human (Homo sapiens) [TaxId:9606] [187499] (9 PDB entries)
  8. 1770723Domain d2jhtb_: 2jht B: [166198]
    automated match to d1ft3a_
    complexed with li, so4; mutant

Details for d2jhtb_

PDB Entry: 2jht (more details), 1.88 Å

PDB Description: crystal structure of rhogdi k135t,k138t,k141t mutant
PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhtb_ b.1.18.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrtgvtidttdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

SCOPe Domain Coordinates for d2jhtb_:

Click to download the PDB-style file with coordinates for d2jhtb_.
(The format of our PDB-style files is described here.)

Timeline for d2jhtb_: