![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
![]() | Protein automated matches [190534] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187499] (10 PDB entries) |
![]() | Domain d2jhtb_: 2jht B: [166198] automated match to d1ft3a_ complexed with li, so4; mutant |
PDB Entry: 2jht (more details), 1.88 Å
SCOPe Domain Sequences for d2jhtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhtb_ b.1.18.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs gmkyiqhtyrtgvtidttdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd dktdhlswewnltikkdw
Timeline for d2jhtb_: