SCOPe 2.05: Domain d2jhsa_: 2jhs A:

Lineage for d2jhsa_ (2jhs A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein automated matches [190534] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187499] (9 PDB entries)

8. Domain d2jhsa_: 2jhs A: [166196]
   automated match to d1ft3a_
   complexed with flc; mutant

Details for d2jhsa_

PDB Entry: 2jhs, 1.95 Å

PDB Description: crystal structure of rhogdi k135h,k138h,k141h mutant

PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhsa_:

Sequence; same for both SEQRES and ATOM records:

>d2jhsa_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
mkyiqhtyrhgvhidhtdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnltikkdw

Timeline for d2jhsa_:

• d2jhsa_ first appeared in SCOPe 2.01
  
• d2jhsa_ appears in SCOPe 2.04
  
• d2jhsa_ appears in SCOPe 2.06
  
• d2jhsa_ appears in the current release, SCOPe 2.08