SCOPe 2.05: Domain d2jhqa_: 2jhq A:

Lineage for d2jhqa_ (2jhq A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein automated matches [190540] (4 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188459] (1 PDB entry)

8. Domain d2jhqa_: 2jhq A: [166195]
   automated match to d1lqja_
   complexed with cl

Details for d2jhqa_

PDB Entry: 2jhq, 1.5 Å

PDB Description: Crystal structure of Uracil DNA-glycosylase from Vibrio cholerae

PDB Compounds: (A:) uracil DNA-glycosylase

SCOPe Domain Sequences for d2jhqa_:

Sequence; same for both SEQRES and ATOM records:

>d2jhqa_ c.18.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
sltwhdvignekqqayfqqtlqfvesqrqagkviyppakdvfnafrftefgdvkvvilgq
dpyhgpnqahglcfsvlpgvktppslvniykelaqdipgfqipphgylqswaqqgvllln
tvltveqgmahshantgwetftdrvidalnqhrnglifllwgshaqkkgqmidrqrhhvl
maphpsplsahrgflgcrhfsktnqllqaqgiapinwqpeles

Timeline for d2jhqa_:

• d2jhqa_ first appeared in SCOPe 2.01
  
• d2jhqa_ appears in SCOPe 2.04
  
• d2jhqa_ appears in SCOPe 2.06
  
• d2jhqa_ appears in the current release, SCOPe 2.08