Lineage for d2jhqa_ (2jhq A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 981872Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 981873Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families) (S)
  5. 981874Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 981925Protein automated matches [190540] (2 species)
    not a true protein
  7. 981929Species Vibrio cholerae [TaxId:666] [188459] (1 PDB entry)
  8. 981930Domain d2jhqa_: 2jhq A: [166195]
    automated match to d1lqja_
    complexed with cl

Details for d2jhqa_

PDB Entry: 2jhq (more details), 1.5 Å

PDB Description: Crystal structure of Uracil DNA-glycosylase from Vibrio cholerae
PDB Compounds: (A:) uracil DNA-glycosylase

SCOPe Domain Sequences for d2jhqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhqa_ c.18.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
sltwhdvignekqqayfqqtlqfvesqrqagkviyppakdvfnafrftefgdvkvvilgq
dpyhgpnqahglcfsvlpgvktppslvniykelaqdipgfqipphgylqswaqqgvllln
tvltveqgmahshantgwetftdrvidalnqhrnglifllwgshaqkkgqmidrqrhhvl
maphpsplsahrgflgcrhfsktnqllqaqgiapinwqpeles

SCOPe Domain Coordinates for d2jhqa_:

Click to download the PDB-style file with coordinates for d2jhqa_.
(The format of our PDB-style files is described here.)

Timeline for d2jhqa_: