Lineage for d2jgba_ (2jgb A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528139Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2528140Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2528226Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2528227Protein automated matches [190708] (10 species)
    not a true protein
  7. 2528256Species Human (Homo sapiens) [TaxId:9606] [187914] (8 PDB entries)
  8. 2528257Domain d2jgba_: 2jgb A: [166174]
    automated match to d1ej1a_
    complexed with mgt

Details for d2jgba_

PDB Entry: 2jgb (more details), 1.7 Å

PDB Description: structure of human eif4e homologous protein 4ehp with m7gtp
PDB Compounds: (A:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d2jgba_:

Sequence, based on SEQRES records: (download)

>d2jgba_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kavvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrp
gdltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvge
eicgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmp
grlgpqrllf

Sequence, based on observed residues (ATOM records): (download)

>d2jgba_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kavvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrp
gdltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvge
eicgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmp
gpqrllf

SCOPe Domain Coordinates for d2jgba_:

Click to download the PDB-style file with coordinates for d2jgba_.
(The format of our PDB-style files is described here.)

Timeline for d2jgba_: