![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
![]() | Superfamily d.86.1: eIF4e-like [55418] (3 families) ![]() |
![]() | Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
![]() | Protein automated matches [190708] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187914] (8 PDB entries) |
![]() | Domain d2jgba_: 2jgb A: [166174] automated match to d1ej1a_ complexed with mgt |
PDB Entry: 2jgb (more details), 1.7 Å
SCOPe Domain Sequences for d2jgba_:
Sequence, based on SEQRES records: (download)
>d2jgba_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kavvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrp gdltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvge eicgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmp grlgpqrllf
>d2jgba_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kavvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrp gdltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvge eicgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmp gpqrllf
Timeline for d2jgba_: