Lineage for d2jg5a_ (2jg5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872643Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1872644Protein automated matches [190117] (37 species)
    not a true protein
  7. 1872822Species Staphylococcus aureus [TaxId:1280] [187913] (3 PDB entries)
  8. 1872827Domain d2jg5a_: 2jg5 A: [166171]
    automated match to d2abqa1

Details for d2jg5a_

PDB Entry: 2jg5 (more details), 2.3 Å

PDB Description: crystal structure of a putative phosphofructokinase from staphylococcus aureus
PDB Compounds: (A:) fructose 1-phosphate kinase

SCOPe Domain Sequences for d2jg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg5a_ c.72.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miytvtfnpsidyviftndfkidglnratatykfaggkginvsrvlktldvestalgfag
gfpgkfiidtlnnsaiqsnfievdedtrinvklktgqeteinapgphitstqfeqllqqi
knttsedivivagsvpssipsdayaqiaqitaqtgaklvvdaekelaesvlpyhplfikp
nkdelevmfnttvnsdadvikygrllvdkgaqsvivslggdgaiyidkeisikavnpqgk
vvntvgsgdstvagmvagiasglsiekafqqavacgtatafdedlatrdaiekiksqvti
svldge

SCOPe Domain Coordinates for d2jg5a_:

Click to download the PDB-style file with coordinates for d2jg5a_.
(The format of our PDB-style files is described here.)

Timeline for d2jg5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jg5b_