Lineage for d4fapb_ (4fap B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2388Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
  5. 2389Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (1 protein)
  6. 2390Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species)
  7. 2391Species Human (Homo sapiens) [TaxId:9606] [47215] (6 PDB entries)
  8. 2397Domain d4fapb_: 4fap B: [16617]
    Other proteins in same PDB: d4fapa_

Details for d4fapb_

PDB Entry: 4fap (more details), 2.8 Å

PDB Description: atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap

SCOP Domain Sequences for d4fapb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens)}
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris

SCOP Domain Coordinates for d4fapb_:

Click to download the PDB-style file with coordinates for d4fapb_.
(The format of our PDB-style files is described here.)

Timeline for d4fapb_: