| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
| Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
| Protein automated matches [190461] (5 species) not a true protein |
| Species Yeast (Candida albicans) [TaxId:5476] [187911] (1 PDB entry) |
| Domain d2jfbo_: 2jfb O: [166167] automated match to d1ejba_ complexed with mpd, po4 |
PDB Entry: 2jfb (more details), 2.5 Å
SCOPe Domain Sequences for d2jfbo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfbo_ c.16.1.1 (O:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
kydgsklrigilharwnrkiidalvagavkrlqefgvkeeniiietvpgsfelpygsklf
vekqkrlgkpldaiipigvlikgstmhfeyicdstthqlmklnfelgipvifgvltcltd
eqaearagliegkmhnhgedwgaaavematkfn
Timeline for d2jfbo_: