Lineage for d2jfbd_ (2jfb D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 981532Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 981533Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 981534Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 981683Protein automated matches [190461] (4 species)
    not a true protein
  7. 981717Species Yeast (Candida albicans) [TaxId:5476] [187911] (1 PDB entry)
  8. 981721Domain d2jfbd_: 2jfb D: [166156]
    automated match to d1ejba_
    complexed with mpd, po4

Details for d2jfbd_

PDB Entry: 2jfb (more details), 2.5 Å

PDB Description: 3d structure of lumazine synthase from candida albicans
PDB Compounds: (D:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d2jfbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfbd_ c.16.1.1 (D:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
kydgsklrigilharwnrkiidalvagavkrlqefgvkeeniiietvpgsfelpygsklf
vekqkrlgkpldaiipigvlikgstmhfeyicdstthqlmklnfelgipvifgvltcltd
eqaearagliegkmhnhgedwgaaavematkfn

SCOPe Domain Coordinates for d2jfbd_:

Click to download the PDB-style file with coordinates for d2jfbd_.
(The format of our PDB-style files is described here.)

Timeline for d2jfbd_: