Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein automated matches [190461] (4 species) not a true protein |
Species Yeast (Candida albicans) [TaxId:5476] [187911] (1 PDB entry) |
Domain d2jfba_: 2jfb A: [166153] automated match to d1ejba_ complexed with mpd, po4 |
PDB Entry: 2jfb (more details), 2.5 Å
SCOPe Domain Sequences for d2jfba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfba_ c.16.1.1 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]} kydgsklrigilharwnrkiidalvagavkrlqefgvkeeniiietvpgsfelpygsklf vekqkrlgkpldaiipigvlikgstmhfeyicdstthqlmklnfelgipvifgvltcltd eqaearagliegkmhnhgedwgaaavematkfn
Timeline for d2jfba_: