Lineage for d2jf0a_ (2jf0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134301Protein automated matches [190065] (6 species)
    not a true protein
  7. 2134368Species Mouse (Mus musculus) [TaxId:10090] [187006] (55 PDB entries)
  8. 2134445Domain d2jf0a_: 2jf0 A: [166151]
    Other proteins in same PDB: d2jf0b2
    automated match to d1maac_
    complexed with hbp, p6g

Details for d2jf0a_

PDB Entry: 2jf0 (more details), 2.5 Å

PDB Description: mus musculus acetylcholinesterase in complex with tabun and ortho-7
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d2jf0a_:

Sequence, based on SEQRES records: (download)

>d2jf0a_ c.69.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
sa

Sequence, based on observed residues (ATOM records): (download)

>d2jf0a_ c.69.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdf
lsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigv
pqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvya
yifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartg
dpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsa

SCOPe Domain Coordinates for d2jf0a_:

Click to download the PDB-style file with coordinates for d2jf0a_.
(The format of our PDB-style files is described here.)

Timeline for d2jf0a_: