Lineage for d2jeda_ (2jed A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (788 PDB entries)
  8. 2545519Domain d2jeda_: 2jed A: [166147]
    Other proteins in same PDB: d2jedb2
    automated match to d1xjda_
    complexed with lg8, mpd

Details for d2jeda_

PDB Entry: 2jed (more details), 2.32 Å

PDB Description: the crystal structure of the kinase domain of the protein kinase c theta in complex with nvp-xaa228 at 2.32a resolution.
PDB Compounds: (A:) protein kinase c theta

SCOPe Domain Sequences for d2jeda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeda_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkiedfelhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlsl
awehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqf
lhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktnefcgtpdyiapeillgq
kynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklf
vrepekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfdcsnfdkeflnekpr
lsfadralinsmdqnmfrnfsfmnpg

SCOPe Domain Coordinates for d2jeda_:

Click to download the PDB-style file with coordinates for d2jeda_.
(The format of our PDB-style files is described here.)

Timeline for d2jeda_: