![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Duke (Dioclea guianensis) [TaxId:99571] [188246] (2 PDB entries) |
![]() | Domain d2je7a_: 2je7 A: [166144] automated match to d1h9pa_ complexed with ca, mn, xmm |
PDB Entry: 2je7 (more details), 1.65 Å
SCOPe Domain Sequences for d2je7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2je7a_ b.29.1.1 (A:) automated matches {Duke (Dioclea guianensis) [TaxId: 99571]} adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr lsavvsysgtssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi adanslhfsfhqfsqnpkdlilqsdattdsdgnlqltrvssdgspqgssvgralfyapvh iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan
Timeline for d2je7a_: