Lineage for d2je7a_ (2je7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779047Species Duke (Dioclea guianensis) [TaxId:99571] [188246] (2 PDB entries)
  8. 2779048Domain d2je7a_: 2je7 A: [166144]
    automated match to d1h9pa_
    complexed with ca, mn, xmm

Details for d2je7a_

PDB Entry: 2je7 (more details), 1.65 Å

PDB Description: crystal structure of recombinant dioclea guianensis lectin s131h complexed with 5-bromo-4-chloro-3-indolyl-a-d-mannose
PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d2je7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2je7a_ b.29.1.1 (A:) automated matches {Duke (Dioclea guianensis) [TaxId: 99571]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
lsavvsysgtssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfhqfsqnpkdlilqsdattdsdgnlqltrvssdgspqgssvgralfyapvh
iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2je7a_:

Click to download the PDB-style file with coordinates for d2je7a_.
(The format of our PDB-style files is described here.)

Timeline for d2je7a_: