SCOPe 2.07: Domain d2fapb_: 2fap B:

Lineage for d2fapb_ (2fap B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)
   automatically mapped to Pfam PF08771

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)

6. Protein mTOR FKBP12–rapamycin-binding (FRB) domain [47214] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47215] (11 PDB entries)

8. Domain d2fapb_: 2fap B: [16614]
   Other proteins in same PDB: d2fapa_
   complexed with rad

Details for d2fapb_

PDB Entry: 2fap, 2.2 Å

PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma

PDB Compounds: (B:) frap

SCOPe Domain Sequences for d2fapb_:

Sequence; same for both SEQRES and ATOM records:

>d2fapb_ a.24.7.1 (B:) mTOR FKBP12–rapamycin-binding (FRB) domain {Human (Homo sapiens) [TaxId: 9606]}
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris

Timeline for d2fapb_:

• d2fapb_ first appeared (with stable ids) in SCOP 1.55
  
• d2fapb_ appears in SCOPe 2.06
  
• d2fapb_ appears in the current release, SCOPe 2.08