Lineage for d2jdpb_ (2jdp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821276Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2821277Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2821278Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2821332Protein automated matches [190094] (4 species)
    not a true protein
  7. 2821366Species Pseudomonas aeruginosa [TaxId:287] [186815] (11 PDB entries)
  8. 2821388Domain d2jdpb_: 2jdp B: [166128]
    automated match to d1gzta_
    complexed with ca, mfu; mutant

Details for d2jdpb_

PDB Entry: 2jdp (more details), 1.3 Å

PDB Description: mutant (s23a) of pseudomonas aeruginosa lectin ii (pa-iil) complexed with methyl-a-l-fucopyranoside
PDB Compounds: (B:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d2jdpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdpb_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafansagtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d2jdpb_:

Click to download the PDB-style file with coordinates for d2jdpb_.
(The format of our PDB-style files is described here.)

Timeline for d2jdpb_: