SCOPe 2.01: Domain d2jdnb_: 2jdn B:

Lineage for d2jdnb_ (2jdn B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)

6. Protein automated matches [190094] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)

8. Domain d2jdnb_: 2jdn B: [166124]
   automated match to d1gzta_
   complexed with ca, fuc, mma, so4; mutant

Details for d2jdnb_

PDB Entry: 2jdn, 1.3 Å

PDB Description: mutant (s22a) of pseudomonas aeruginosa lectin ii (pa-iil) complexed with methyl-a-l-mannopyranoside

PDB Compounds: (B:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d2jdnb_:

Sequence; same for both SEQRES and ATOM records:

>d2jdnb_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanasgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d2jdnb_:

• d2jdnb_ is new in SCOPe 2.01-stable
  
• d2jdnb_ appears in SCOPe 2.02
  
• d2jdnb_ appears in the current release, SCOPe 2.08