![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) ![]() automatically mapped to Pfam PF08771 |
![]() | Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
![]() | Protein mTOR FKBP12–rapamycin-binding (FRB) domain [47214] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47215] (11 PDB entries) |
![]() | Domain d3fapb_: 3fap B: [16612] Other proteins in same PDB: d3fapa_ complexed with ard |
PDB Entry: 3fap (more details), 1.85 Å
SCOPe Domain Sequences for d3fapb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fapb_ a.24.7.1 (B:) mTOR FKBP12–rapamycin-binding (FRB) domain {Human (Homo sapiens) [TaxId: 9606]} vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl meaqewcrkymksgnvkdltqawdlyyhvfrris
Timeline for d3fapb_: