SCOPe 2.08: Domain d1ivhd1: 1ivh D:242-392

Lineage for d1ivhd1 (1ivh D:242-392)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein Isovaleryl-CoA dehydrogenase, C-domain [47210] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47211] (1 PDB entry)

8. Domain d1ivhd1: 1ivh D:242-392 [16611]
   Other proteins in same PDB: d1ivha2, d1ivhb2, d1ivhc2, d1ivhd2
   complexed with cos, fad

Details for d1ivhd1

PDB Entry: 1ivh, 2.6 Å

PDB Description: structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity

PDB Compounds: (D:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d1ivhd1:

Sequence; same for both SEQRES and ATOM records:

>d1ivhd1 a.29.3.1 (D:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
kgvyvlmsgldlerlvlaggplglmqavldhtipylhvreafgqkighfqlmqgkmadmy
trlmacrqyvynvakacdeghctakdcagvilysaecatqvaldgiqcfggngyindfpm
grflrdaklyeigagtsevrrlvigrafnad

Timeline for d1ivhd1:

• d1ivhd1 first appeared (with stable ids) in SCOP 1.55
  
• d1ivhd1 appears in SCOPe 2.07