Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2jd8q_ (2jd8 Q:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (12 species)
    not a true protein
  7. Species Pyrococcus furiosus [TaxId:2261] [187908] (3 PDB entries)
  8. Domain d2jd8q_: 2jd8 Q: [166109]
    automated match to d1vlga_
    complexed with fe, so4, zn

Details for d2jd8q_

PDB Entry: 2jd8 (more details)
PDB Description: crystal structure of the zn-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
PDB Compounds: (Q:) ferritin homolog

SCOP Domain Sequences for d2jd8q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd8q_ a.25.1.0 (Q:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg

SCOP Domain Coordinates for d2jd8q_:

Click to download the PDB-style file with coordinates for d2jd8q_.
(The format of our PDB-style files is described here.)

Timeline for d2jd8q_:

d2jd8q_ appears in SCOP 1.75A


d2jd8q_
(click for larger image)


d2jd8q_ in context of chain



d2jd8q_ in context of PDB
Domains from other chains:
d2jd80_, d2jd81_, d2jd82_, d2jd83_, d2jd84_, d2jd85_, d2jd86_, d2jd87_, d2jd88_, d2jd89_, d2jd8a_, d2jd8b_, d2jd8c_, d2jd8d_, d2jd8e_, d2jd8f_, d2jd8g_, d2jd8h_, d2jd8i_, d2jd8j_, d2jd8k_, d2jd8l_, d2jd8m_, d2jd8n_, d2jd8o_, d2jd8p_, d2jd8r_, d2jd8s_, d2jd8t_, d2jd8u_, d2jd8v_, d2jd8w_, d2jd8x_, d2jd8y_, d2jd8z_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu