![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
![]() | Protein Isovaleryl-CoA dehydrogenase, C-domain [47210] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47211] (1 PDB entry) |
![]() | Domain d1ivha1: 1ivh A:242-392 [16608] Other proteins in same PDB: d1ivha2, d1ivhb2, d1ivhc2, d1ivhd2 complexed with cos, fad |
PDB Entry: 1ivh (more details), 2.6 Å
SCOPe Domain Sequences for d1ivha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} kgvyvlmsgldlerlvlaggplglmqavldhtipylhvreafgqkighfqlmqgkmadmy trlmacrqyvynvakacdeghctakdcagvilysaecatqvaldgiqcfggngyindfpm grflrdaklyeigagtsevrrlvigrafnad
Timeline for d1ivha1: