Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2jd7w_ (2jd7 W:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (12 species)
    not a true protein
  7. Species Pyrococcus furiosus [TaxId:2261] [187908] (3 PDB entries)
  8. Domain d2jd7w_: 2jd7 W: [166079]
    automated match to d1vlga_
    complexed with fe, so4

Details for d2jd7w_

PDB Entry: 2jd7 (more details)
PDB Description: crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
PDB Compounds: (W:) ferritin homolog

SCOP Domain Sequences for d2jd7w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd7w_ a.25.1.0 (W:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg

SCOP Domain Coordinates for d2jd7w_:

Click to download the PDB-style file with coordinates for d2jd7w_.
(The format of our PDB-style files is described here.)

Timeline for d2jd7w_:

d2jd7w_ appears in SCOP 1.75A


d2jd7w_
(click for larger image)


d2jd7w_ in context of chain



d2jd7w_ in context of PDB
Domains from other chains:
d2jd70_, d2jd71_, d2jd72_, d2jd73_, d2jd74_, d2jd75_, d2jd76_, d2jd77_, d2jd78_, d2jd79_, d2jd7a_, d2jd7b_, d2jd7c_, d2jd7d_, d2jd7e_, d2jd7f_, d2jd7g_, d2jd7h_, d2jd7i_, d2jd7j_, d2jd7k_, d2jd7l_, d2jd7m_, d2jd7n_, d2jd7o_, d2jd7p_, d2jd7q_, d2jd7r_, d2jd7s_, d2jd7t_, d2jd7u_, d2jd7v_, d2jd7x_, d2jd7y_, d2jd7z_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu