| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (12 species) not a true protein |
| Species Pyrococcus furiosus [TaxId:2261] [187908] (3 PDB entries) |
| Domain d2jd78_: 2jd7 8: [166055] automated match to d1vlga_ complexed with fe, so4 |
| PDB Entry: 2jd7 (more details) PDB Description: crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
PDB Compounds: (8:) ferritin homologSCOP Domain Sequences for d2jd78_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jd78_ a.25.1.0 (8:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
SCOP Domain Coordinates for d2jd78_:
Click to download the PDB-style file with coordinates for d2jd78_. (The format of our PDB-style files is described here.)
Timeline for d2jd78_:
d2jd78_ appears in SCOP 1.75A | d2jd78_ (click for larger image) d2jd78_ in context of chain d2jd78_ in context of PDB Domains from other chains: d2jd70_, d2jd71_, d2jd72_, d2jd73_, d2jd74_, d2jd75_, d2jd76_, d2jd77_, d2jd79_, d2jd7a_, d2jd7b_, d2jd7c_, d2jd7d_, d2jd7e_, d2jd7f_, d2jd7g_, d2jd7h_, d2jd7i_, d2jd7j_, d2jd7k_, d2jd7l_, d2jd7m_, d2jd7n_, d2jd7o_, d2jd7p_, d2jd7q_, d2jd7r_, d2jd7s_, d2jd7t_, d2jd7u_, d2jd7v_, d2jd7w_, d2jd7x_, d2jd7y_, d2jd7z_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |