Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1egeb1 (1ege B:242-396)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains)
  6. Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
    Uniprot P11310 34-421
  8. Domain d1egeb1: 1ege B:242-396 [16605]
    Other proteins in same PDB: d1egea2, d1egeb2, d1egec2, d1eged2
    complexed with fad; mutant

Details for d1egeb1

PDB Entry: 1ege (more details)
PDB Description: structure of t255e, e376g mutant of human medium chain acyl- coa dehydrogenase
PDB Compounds: (B:) medium chain acyl-coa dehydrogenase

SCOP Domain Sequences for d1egeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egeb1 a.29.3.1 (B:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkykn

SCOP Domain Coordinates for d1egeb1:

Click to download the PDB-style file with coordinates for d1egeb1.
(The format of our PDB-style files is described here.)

Timeline for d1egeb1:

d1egeb1 appears in SCOP 1.75A


d1egeb1
(click for larger image)


d1egeb1 in context of chain
Domains from same chain:
d1egeb2


d1egeb1 in context of PDB
Domains from other chains:
d1egea1, d1egea2, d1egec1, d1egec2, d1eged1, d1eged2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu