| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains) |
| Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries) Uniprot P11310 34-421 |
| Domain d1egeb1: 1ege B:242-396 [16605] Other proteins in same PDB: d1egea2, d1egeb2, d1egec2, d1eged2 complexed with fad; mutant |
| PDB Entry: 1ege (more details) PDB Description: structure of t255e, e376g mutant of human medium chain acyl- coa dehydrogenase
PDB Compounds: (B:) medium chain acyl-coa dehydrogenaseSCOP Domain Sequences for d1egeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egeb1 a.29.3.1 (B:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkykn
SCOP Domain Coordinates for d1egeb1:
Click to download the PDB-style file with coordinates for d1egeb1. (The format of our PDB-style files is described here.)
Timeline for d1egeb1:
d1egeb1 appears in SCOP 1.75A | d1egeb1 (click for larger image) d1egeb1 in context of chain Domains from same chain: d1egeb2 d1egeb1 in context of PDB Domains from other chains: d1egea1, d1egea2, d1egec1, d1egec2, d1eged1, d1eged2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |