Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2jd6s_ (2jd6 S:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (12 species)
    not a true protein
  7. Species Pyrococcus furiosus [TaxId:2261] [187908] (3 PDB entries)
  8. Domain d2jd6s_: 2jd6 S: [166039]
    automated match to d1vlga_
    complexed with fe, so4

Details for d2jd6s_

PDB Entry: 2jd6 (more details)
PDB Description: crystal structure of the as isolated ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
PDB Compounds: (S:) ferritin homolog

SCOP Domain Sequences for d2jd6s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd6s_ a.25.1.0 (S:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg

SCOP Domain Coordinates for d2jd6s_:

Click to download the PDB-style file with coordinates for d2jd6s_.
(The format of our PDB-style files is described here.)

Timeline for d2jd6s_:

d2jd6s_ appears in SCOP 1.75A


d2jd6s_
(click for larger image)


d2jd6s_ in context of chain



d2jd6s_ in context of PDB
Domains from other chains:
d2jd60_, d2jd61_, d2jd62_, d2jd63_, d2jd64_, d2jd65_, d2jd66_, d2jd67_, d2jd68_, d2jd69_, d2jd6a_, d2jd6b_, d2jd6c_, d2jd6d_, d2jd6e_, d2jd6f_, d2jd6g_, d2jd6h_, d2jd6i_, d2jd6j_, d2jd6k_, d2jd6l_, d2jd6m_, d2jd6n_, d2jd6o_, d2jd6p_, d2jd6q_, d2jd6r_, d2jd6t_, d2jd6u_, d2jd6v_, d2jd6w_, d2jd6x_, d2jd6y_, d2jd6z_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu