| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
| Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries) Uniprot P11310 34-421 |
| Domain d1egcc1: 1egc C:242-396 [16602] Other proteins in same PDB: d1egca2, d1egcb2, d1egcc2, d1egcd2 complexed with co8, fad; mutant |
PDB Entry: 1egc (more details), 2.6 Å
SCOPe Domain Sequences for d1egcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egcc1 a.29.3.1 (C:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyggtsqiqrlivarehidkykn
Timeline for d1egcc1: