![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187909] (1 PDB entry) |
![]() | Domain d2jd5b_: 2jd5 B: [166010] automated match to d1q8zb_ complexed with mg, so4 |
PDB Entry: 2jd5 (more details), 2.5 Å
SCOPe Domain Sequences for d2jd5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jd5b_ d.144.1.7 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedeikl lqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehrgi pliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnacwy dehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkddd hiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskdeak eisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr
Timeline for d2jd5b_: