SCOPe 2.08: Domain d2jd5b_: 2jd5 B:

Lineage for d2jd5b_ (2jd5 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187909] (1 PDB entry)

8. Domain d2jd5b_: 2jd5 B: [166010]
   automated match to d1q8zb_
   complexed with mg, so4

Details for d2jd5b_

PDB Entry: 2jd5, 2.5 Å

PDB Description: sky1p bound to npl3p-derived substrate peptide

PDB Compounds: (B:) serine/threonine-protein kinase sky1

SCOPe Domain Sequences for d2jd5b_:

Sequence; same for both SEQRES and ATOM records:

>d2jd5b_ d.144.1.7 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedeikl
lqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehrgi
pliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnacwy
dehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkddd
hiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskdeak
eisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr

Timeline for d2jd5b_:

• d2jd5b_ first appeared in SCOPe 2.01
  
• d2jd5b_ appears in SCOPe 2.07