Lineage for d2jd5a_ (2jd5 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674002Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187909] (1 PDB entry)
  8. 1674003Domain d2jd5a_: 2jd5 A: [166009]
    automated match to d1q8zb_
    complexed with mg, so4

Details for d2jd5a_

PDB Entry: 2jd5 (more details), 2.5 Å

PDB Description: sky1p bound to npl3p-derived substrate peptide
PDB Compounds: (A:) serine/threonine-protein kinase sky1

SCOPe Domain Sequences for d2jd5a_:

Sequence, based on SEQRES records: (download)

>d2jd5a_ d.144.1.7 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkd
ddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskde
akeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfee
vrd

Sequence, based on observed residues (ATOM records): (download)

>d2jd5a_ d.144.1.7 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflftkdddhiaqii
ellgelpsyllrngkytrtffnsllrnisklkfwpledvltekykfskdeakeisdflsp
mlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevrd

SCOPe Domain Coordinates for d2jd5a_:

Click to download the PDB-style file with coordinates for d2jd5a_.
(The format of our PDB-style files is described here.)

Timeline for d2jd5a_: