SCOPe 2.01: Domain d2jc4a_: 2jc4 A:

Lineage for d2jc4a_ (2jc4 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (2 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:487] [187907] (1 PDB entry)

8. Domain d2jc4a_: 2jc4 A: [166003]
   automated match to d1akoa_
   complexed with 1pe, 2hp, act, mg, na

Details for d2jc4a_

PDB Entry: 2jc4, 1.9 Å

PDB Description: 3'-5' exonuclease (nexo) from neisseria meningitidis

PDB Compounds: (A:) exodeoxyribonuclease III

SCOPe Domain Sequences for d2jc4a_:

Sequence; same for both SEQRES and ATOM records:

>d2jc4a_ d.151.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 487]}
mkittwnvnslnvrlpqvqnlladnppdilvlqelkldqdkfpaaalqmmgwhcvwsgqk
tyngvaivsrsvpqdvhfglpalpddpqrrviaatvsgvrvinvycvngealdspkfkyk
eqwfaaltefvrdemtrhgklvllgdfniapadadcydpekwhekihcssverqwfqnll
dlgltdslrqvhpegafytwfdyrgamfqrklglridhilvspamaaalkdvrvdletra
lerpsdhapvtaefdw

Timeline for d2jc4a_:

• d2jc4a_ is new in SCOPe 2.01-stable
  
• d2jc4a_ appears in SCOPe 2.02
  
• d2jc4a_ appears in the current release, SCOPe 2.08