Lineage for d1egdd1 (1egd D:242-396)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708345Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2708386Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 2708387Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
    Uniprot P11310 34-421
  8. 2708395Domain d1egdd1: 1egd D:242-396 [16599]
    Other proteins in same PDB: d1egda2, d1egdb2, d1egdc2, d1egdd2
    complexed with fad; mutant

Details for d1egdd1

PDB Entry: 1egd (more details), 2.4 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase
PDB Compounds: (D:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d1egdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egdd1 a.29.3.1 (D:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyggtsqiqrlivarehidkykn

SCOPe Domain Coordinates for d1egdd1:

Click to download the PDB-style file with coordinates for d1egdd1.
(The format of our PDB-style files is described here.)

Timeline for d1egdd1: