Lineage for d2jblc_ (2jbl C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1283685Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1283686Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1283784Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 1283785Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 1283786Species Rhodopseudomonas viridis [TaxId:1079] [48709] (16 PDB entries)
  8. 1283794Domain d2jblc_: 2jbl C: [165986]
    Other proteins in same PDB: d2jblh1, d2jblh2, d2jbll_, d2jblm_
    complexed with bcb, bpb, fe, hem, lda, mq7, ns5, sma, so4

Details for d2jblc_

PDB Entry: 2jbl (more details), 2.4 Å

PDB Description: photosynthetic reaction center from blastochloris viridis
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2jblc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jblc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d2jblc_:

Click to download the PDB-style file with coordinates for d2jblc_.
(The format of our PDB-style files is described here.)

Timeline for d2jblc_: