Lineage for d2jbhb_ (2jbh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128615Protein automated matches [190074] (13 species)
    not a true protein
  7. 2128628Species Human (Homo sapiens) [TaxId:9606] [187905] (1 PDB entry)
  8. 2128630Domain d2jbhb_: 2jbh B: [165985]
    automated match to d1bzya_
    complexed with 5gp, ca, po4

Details for d2jbhb_

PDB Entry: 2jbh (more details), 1.7 Å

PDB Description: human phosphoribosyl transferase domain containing 1
PDB Compounds: (B:) phosphoribosyltransferase domain-containing protein 1

SCOPe Domain Sequences for d2jbhb_:

Sequence, based on SEQRES records: (download)

>d2jbhb_ c.61.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdygrgvvimddwpgydlnlftypqhyygdleyvliphgiivdrierlakdimkdigysd
imvlcvlkggykfcadlvehlknisrnsdrfvsmkvdfirlksyrndqsmgemqiiggdd
lstlagknvlivedvvgtgrtmkallsniekykpnmikvasllvkrtsrsdgfrpdyagf
eipnlfvvgyaldyneyfrdlnhicvinehgkekyrv

Sequence, based on observed residues (ATOM records): (download)

>d2jbhb_ c.61.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdygrgvvimddwpgydlnlftypqhyygdleyvliphgiivdrierlakdimkdigysd
imvlcvlkggykfcadlvehlknisrnsdrfvsmkvdfirlksyrndqsmgemqiiggdd
lstlagknvlivedvvgtgrtmkallsniekykpnmikvasllvkrtgfrpdyagfeipn
lfvvgyaldyneyfrdlnhicvinehgkekyrv

SCOPe Domain Coordinates for d2jbhb_:

Click to download the PDB-style file with coordinates for d2jbhb_.
(The format of our PDB-style files is described here.)

Timeline for d2jbhb_: