| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein automated matches [190177] (9 species) not a true protein |
| Species Escherichia coli [TaxId:562] [186909] (5 PDB entries) |
| Domain d2jb9b_: 2jb9 B: [165981] automated match to d1b00a_ mutant |
PDB Entry: 2jb9 (more details), 1.7 Å
SCOPe Domain Sequences for d2jb9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jb9b_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
arrilvveaeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillewmlpggsg
iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr
ri
Timeline for d2jb9b_: