Lineage for d2jb7a_ (2jb7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614818Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 2614819Superfamily d.256.1: Ta1353-like [103165] (2 families) (S)
  5. 2614832Family d.256.1.0: automated matches [191419] (1 protein)
    not a true family
  6. 2614833Protein automated matches [190589] (4 species)
    not a true protein
  7. 2614834Species Pyrobaculum aerophilum [TaxId:13773] [188096] (2 PDB entries)
  8. 2614838Domain d2jb7a_: 2jb7 A: [165977]
    automated match to d1vgga_
    complexed with act, amp, epe

Details for d2jb7a_

PDB Entry: 2jb7 (more details), 1.65 Å

PDB Description: pae2307 with amp
PDB Compounds: (A:) hypothetical protein pae2307

SCOPe Domain Sequences for d2jb7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jb7a_ d.256.1.0 (A:) automated matches {Pyrobaculum aerophilum [TaxId: 13773]}
sikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhe
andeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviv
aeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl

SCOPe Domain Coordinates for d2jb7a_:

Click to download the PDB-style file with coordinates for d2jb7a_.
(The format of our PDB-style files is described here.)

Timeline for d2jb7a_: