Lineage for d2jasc1 (2jas C:1-200)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128993Species Mycoplasma mycoides [TaxId:44101] [187903] (3 PDB entries)
  8. 2129000Domain d2jasc1: 2jas C:1-200 [165971]
    Other proteins in same PDB: d2jasc2, d2jasf2
    automated match to d1j90a_
    complexed with dtp, mg

Details for d2jasc1

PDB Entry: 2jas (more details), 2.7 Å

PDB Description: structure of deoxyadenosine kinase from m.mycoides with bound datp
PDB Compounds: (C:) deoxyguanosine kinase

SCOPe Domain Sequences for d2jasc1:

Sequence, based on SEQRES records: (download)

>d2jasc1 c.37.1.0 (C:1-200) automated matches {Mycoplasma mycoides [TaxId: 44101]}
mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkipe
nklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffv
vdaeldvktqielimnklns

Sequence, based on observed residues (ATOM records): (download)

>d2jasc1 c.37.1.0 (C:1-200) automated matches {Mycoplasma mycoides [TaxId: 44101]}
mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenllsfd
iviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeld
vktqielimnklns

SCOPe Domain Coordinates for d2jasc1:

Click to download the PDB-style file with coordinates for d2jasc1.
(The format of our PDB-style files is described here.)

Timeline for d2jasc1: