SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1egdb1 (1egd B:242-396)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992885Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1992886Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 protein domains)
  6. 1992927Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 1992928Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
    Uniprot P11310 34-421
  8. 1992934Domain d1egdb1: 1egd B:242-396 [16597]
    Other proteins in same PDB: d1egda2, d1egdb2, d1egdc2, d1egdd2
    complexed with fad; mutant

Details for d1egdb1

PDB Entry: 1egd (more details), 2.4 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase
PDB Compounds: (B:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d1egdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egdb1 a.29.3.1 (B:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyggtsqiqrlivarehidkykn

SCOPe Domain Coordinates for d1egdb1:

Click to download the PDB-style file with coordinates for d1egdb1.
(The format of our PDB-style files is described here.)

Timeline for d1egdb1: