Lineage for d2jaqa_ (2jaq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114560Species Mycoplasma mycoides [TaxId:44101] [187903] (3 PDB entries)
  8. 2114561Domain d2jaqa_: 2jaq A: [165966]
    automated match to d1j90a_
    complexed with dcp

Details for d2jaqa_

PDB Entry: 2jaq (more details), 2.3 Å

PDB Description: structure of deoxyadenosine kinase from m. mycoides with bound dctp
PDB Compounds: (A:) deoxyguanosine kinase

SCOPe Domain Sequences for d2jaqa_:

Sequence, based on SEQRES records: (download)

>d2jaqa_ c.37.1.0 (A:) automated matches {Mycoplasma mycoides [TaxId: 44101]}
mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkipe
nklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffv
vdaeldvktqielimnklnsi

Sequence, based on observed residues (ATOM records): (download)

>d2jaqa_ c.37.1.0 (A:) automated matches {Mycoplasma mycoides [TaxId: 44101]}
mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
rskqlkniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenklsfdiviylr
vstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldvktqie
limnklnsi

SCOPe Domain Coordinates for d2jaqa_:

Click to download the PDB-style file with coordinates for d2jaqa_.
(The format of our PDB-style files is described here.)

Timeline for d2jaqa_: