Lineage for d2jaoa_ (2jao A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919888Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 2919895Protein automated matches [190171] (2 species)
    not a true protein
  7. 2919920Species Mouse (Mus musculus) [TaxId:10090] [188278] (2 PDB entries)
  8. 2919922Domain d2jaoa_: 2jao A: [165965]
    automated match to d1z4ia1
    complexed with dgp, gol, mg

Details for d2jaoa_

PDB Entry: 2jao (more details), 2 Å

PDB Description: crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate
PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d2jaoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jaoa_ c.108.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krpvrvlvnmdgvladfesgllqgfrrrfpeephvpleqrrgflaneqygalrpdlaekv
asvyespgfflnlepipgaldalremndmkdtevficttpllkydhcvgekyrwveqnlg
pefveriiltrdktvvmgdlliddkdniqgleetpswehilftcchnqhlalpptrrrll
swsdnwrgiieskras

SCOPe Domain Coordinates for d2jaoa_:

Click to download the PDB-style file with coordinates for d2jaoa_.
(The format of our PDB-style files is described here.)

Timeline for d2jaoa_: