Lineage for d2jajb_ (2jaj B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668203Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 1668204Protein automated matches [190175] (6 species)
    not a true protein
  7. 1668214Species Human (Homo sapiens) [TaxId:9606] [187904] (6 PDB entries)
  8. 1668222Domain d2jajb_: 2jaj B: [165962]
    automated match to d1h70a_
    complexed with d20

Details for d2jajb_

PDB Entry: 2jaj (more details), 2 Å

PDB Description: ddah1 complexed with l-257
PDB Compounds: (B:) ng, ng-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d2jajb_:

Sequence, based on SEQRES records: (download)

>d2jajb_ d.126.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgmaglghpaafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgs
klglqvvelpadeslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlni
vemkdenatldggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlks
fcsmagpnliaigssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllh
rtpeeypesakvyeklkdhmlipvsmselekvdglltccsvlinkk

Sequence, based on observed residues (ATOM records): (download)

>d2jajb_ d.126.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgmaglghpaafgrathavvralpeslgqhalrsakevdvaraerqhqlyvgvlgskl
glqvvelpadeslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnive
mkdenatldggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvlhlksfcsma
gpnliaigssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpee
ypesakvyeklkdhmlipvsmselekvdglltccsvlinkk

SCOPe Domain Coordinates for d2jajb_:

Click to download the PDB-style file with coordinates for d2jajb_.
(The format of our PDB-style files is described here.)

Timeline for d2jajb_: