Lineage for d2j9wa1 (2j9w A:123-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700773Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) (S)
  5. 2700789Family a.24.28.0: automated matches [191467] (1 protein)
    not a true family
  6. 2700790Protein automated matches [190732] (1 species)
    not a true protein
  7. 2700791Species African clawed frog (Xenopus laevis) [TaxId:8355] [187900] (1 PDB entry)
  8. 2700792Domain d2j9wa1: 2j9w A:123-220 [165957]
    Other proteins in same PDB: d2j9wa2, d2j9wb2
    automated match to d2g3ka1

Details for d2j9wa1

PDB Entry: 2j9w (more details), 1.3 Å

PDB Description: structural insight into the escrt-i-ii link and its role in mvb trafficking
PDB Compounds: (A:) vps28-prov protein

SCOPe Domain Sequences for d2j9wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9wa1 a.24.28.0 (A:123-220) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gnlnrciadivslfitvmdklrleiramdeiqpdlrelmetmnrmshlppdfegrekvsq
wlqklssmsasdelddsqvrqmlfdlesaynafnrflh

SCOPe Domain Coordinates for d2j9wa1:

Click to download the PDB-style file with coordinates for d2j9wa1.
(The format of our PDB-style files is described here.)

Timeline for d2j9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j9wa2