![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) ![]() |
![]() | Family a.24.28.0: automated matches [191467] (1 protein) not a true family |
![]() | Protein automated matches [190732] (1 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [187900] (1 PDB entry) |
![]() | Domain d2j9wa1: 2j9w A:123-220 [165957] Other proteins in same PDB: d2j9wa2, d2j9wb2 automated match to d2g3ka1 |
PDB Entry: 2j9w (more details), 1.3 Å
SCOPe Domain Sequences for d2j9wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9wa1 a.24.28.0 (A:123-220) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} gnlnrciadivslfitvmdklrleiramdeiqpdlrelmetmnrmshlppdfegrekvsq wlqklssmsasdelddsqvrqmlfdlesaynafnrflh
Timeline for d2j9wa1: