SCOPe 2.08: Domain d2j9wa1: 2j9w A:123-220

Lineage for d2j9wa1 (2j9w A:123-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families)

5. Family a.24.28.0: automated matches [191467] (1 protein)
   not a true family

6. Protein automated matches [190732] (1 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [187900] (1 PDB entry)

8. Domain d2j9wa1: 2j9w A:123-220 [165957]
   Other proteins in same PDB: d2j9wa2, d2j9wb2
   automated match to d2g3ka1

Details for d2j9wa1

PDB Entry: 2j9w, 1.3 Å

PDB Description: structural insight into the escrt-i-ii link and its role in mvb trafficking

PDB Compounds: (A:) vps28-prov protein

SCOPe Domain Sequences for d2j9wa1:

Sequence; same for both SEQRES and ATOM records:

>d2j9wa1 a.24.28.0 (A:123-220) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gnlnrciadivslfitvmdklrleiramdeiqpdlrelmetmnrmshlppdfegrekvsq
wlqklssmsasdelddsqvrqmlfdlesaynafnrflh

Timeline for d2j9wa1:

• d2j9wa1 first appeared in SCOPe 2.01, called d2j9wa_
  
• d2j9wa1 appears in SCOPe 2.07