Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein automated matches [190098] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186820] (5 PDB entries) |
Domain d2j9fc_: 2j9f C: [165953] Other proteins in same PDB: d2j9fb1, d2j9fb2, d2j9fb3, d2j9fd1, d2j9fd2, d2j9fd3 automated match to d1olxa_ complexed with gol, k, mn, thv |
PDB Entry: 2j9f (more details), 1.88 Å
SCOPe Domain Sequences for d2j9fc_:
Sequence, based on SEQRES records: (download)
>d2j9fc_ c.36.1.11 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg ygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssayrpvde vnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfs dvyqempaqlrkqqeslarhlqtygehypldhfdk
>d2j9fc_ c.36.1.11 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg ygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssaydhpis rlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrk qqeslarhlqtygehypldhfdk
Timeline for d2j9fc_: