SCOPe 2.06: Domain d2j98b_: 2j98 B:

Lineage for d2j98b_ (2j98 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (2 families)

5. Family b.140.1.0: automated matches [191526] (1 protein)
   not a true family

6. Protein automated matches [190886] (3 species)
   not a true protein

7. Species Human coronavirus 229E [TaxId:11137] [188277] (2 PDB entries)

8. Domain d2j98b_: 2j98 B: [165951]
   automated match to d1uw7a_
   complexed with dtt; mutant

Details for d2j98b_

PDB Entry: 2j98, 1.8 Å

PDB Description: human coronavirus 229e non structural protein 9 cys69ala mutant (nsp9)

PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2j98b_:

Sequence; same for both SEQRES and ATOM records:

>d2j98b_ b.140.1.0 (B:) automated matches {Human coronavirus 229E [TaxId: 11137]}
kpgkmkvkatkgegdggitsegnalynneggrafmyayvttkpgmkyvkwehdsgvvtve
lepparfvidtptgpqikylyfvknlnnlrrgavlgyigatv

Timeline for d2j98b_:

• d2j98b_ first appeared in SCOPe 2.01
  
• d2j98b_ appears in SCOPe 2.05
  
• d2j98b_ appears in SCOPe 2.07
  
• d2j98b_ appears in the current release, SCOPe 2.08