| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
| Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [47208] (3 PDB entries) |
| Domain d3mdeb1: 3mde B:242-395 [16595] Other proteins in same PDB: d3mdea2, d3mdeb2 complexed with co8, fad |
PDB Entry: 3mde (more details), 2.4 Å
SCOPe Domain Sequences for d3mdeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mdeb1 a.29.3.1 (B:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]}
gagfkiamgtfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladm
amkvelarlsyqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteyp
veklmrdakiyqiyegtaqiqriiiarehigryk
Timeline for d3mdeb1: