Lineage for d2j8ra_ (2j8r A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1427016Protein Hypothetical protein PA4866 [143694] (1 species)
    Putative phosphinothricin acetyltransferase
  7. 1427017Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries)
    Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172
  8. 1427020Domain d2j8ra_: 2j8r A: [165945]
    automated match to d2bl1a1
    complexed with azi, gol, msl

Details for d2j8ra_

PDB Entry: 2j8r (more details), 1.55 Å

PDB Description: structure of p. aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine
PDB Compounds: (A:) acetyltransferase pa4866 from p. aeruginosa

SCOPe Domain Sequences for d2j8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8ra_ d.108.1.1 (A:) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasdaa
gevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaa
iesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

SCOPe Domain Coordinates for d2j8ra_:

Click to download the PDB-style file with coordinates for d2j8ra_.
(The format of our PDB-style files is described here.)

Timeline for d2j8ra_: