Lineage for d2j8ma_ (2j8m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968529Protein Hypothetical protein PA4866 [143694] (1 species)
    Putative phosphinothricin acetyltransferase
  7. 2968530Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries)
    Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172
  8. 2968531Domain d2j8ma_: 2j8m A: [165941]
    automated match to d2bl1a1
    complexed with azi, gol, so4

Details for d2j8ma_

PDB Entry: 2j8m (more details), 1.44 Å

PDB Description: structure of p. aeruginosa acetyltransferase pa4866
PDB Compounds: (A:) acetyltransferase pa4866 from p. aeruginosa

SCOPe Domain Sequences for d2j8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8ma_ d.108.1.1 (A:) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
sasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdararqgypilvasda
agevlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmva
aiesgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

SCOPe Domain Coordinates for d2j8ma_:

Click to download the PDB-style file with coordinates for d2j8ma_.
(The format of our PDB-style files is described here.)

Timeline for d2j8ma_: