Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein automated matches [190276] (11 species) not a true protein |
Species Desulfovibrio vulgaris [TaxId:882] [187896] (2 PDB entries) |
Domain d2j7ak_: 2j7a K: [165934] automated match to d1oaha_ complexed with act, ca, hem, lmt |
PDB Entry: 2j7a (more details), 2.3 Å
SCOPe Domain Sequences for d2j7ak_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7ak_ a.138.1.3 (K:) automated matches {Desulfovibrio vulgaris [TaxId: 882]} agcsdvstelktpvyktkltaeeirnsafkpefpkqyasyerndettvmteykgsvpfnk ndnvnplpegyrhaqpylknlwlgypfmyeyrearghtyaiqdflhidrinryaekgglp atcwncktpkmmewvkesgdgfwakdvnefrdkidmkdhtigcatchdpqtmelritsvp ltdylvsqgkdpkklprnemralvcgqchveyyfngptmgvnkkpvfpwaegfdpadmyr yydkhgdlqvkgfegkfadwthpasktpmikaqhpeyetwingthgaagvtcadchmsyt rsddkkkisshwwtspmkdpemracrqchsdktpdylksrvlftqkrtfdlllaaqevsv kaheavrlaneyqgakaagyddlmiqaremvrkgqffwdyvsaensvgfhnpakaldtla qsqqfsqkaidlameatqygigkdlsgdiktivppilkmnrklqqdpefmkthkwfqylp vlpkadqvwdgqkrlv
Timeline for d2j7ak_: